Company Details
  • Conbott Pharmtech Co.,Ltd.

  •  [Zhejiang,China]
  • Business Type:Manufacturer
  • Main Mark: Africa , Americas , Asia , Caribbean , East Europe , Europe , Middle East , North Europe , Oceania , Other Markets , West Europe , Worldwide
  • Exporter:71% - 80%
  • Certs:COS, ISO9001, ISO14010, FDA
  • Description:106612-94-6,CAS 106612-94-6,CAS NO 106612-94-6
Conbott Pharmtech Co.,Ltd. 106612-94-6,CAS 106612-94-6,CAS NO 106612-94-6
Home > Products > Peptide Synthesis > 99% Human Growth Hormone Peptide GLP-1 CAS 106612-94-6
Title
  • Title
  • All
Online Service
http://www.conbottpharm.comScan to visit

99% Human Growth Hormone Peptide GLP-1 CAS 106612-94-6

Share to:  
    Payment Type: T/T,L/C
    Min. Order: 1 Gram
    Delivery Time: 10 Days

Basic Info

Model No.: 106612-94-6

Additional Info

Packaging: As required

Productivity: Customized

Brand: Conbottpharm

Transportation: Ocean,Air

Place of Origin: China

Supply Ability: Commercial

Certificate: Documents Support

Product Description

We offer great quality and high purity GLP-1 CAS 106612-94-6. Glucagon like peptide -1 (GLP-1) is a brain gut peptides secretion ileal endocrine cells, at present mainly as a target for type 2 diabetes drug action. The advantage of GLP-1 CAS 106612-94-6 can reduce the inhibition of gastric emptying, intestinal peristalsis. This provides a very good prospect for the treatment of type 2 Diabetes Mellitus. But because GLP-1 is a polypeptide, cannot be administered orally is a major shortcoming. We are skillful to produce high purity GLP-1. We can provide different packaging to meet customers requirement.


Thera. Category: Anti-type 2 diabetes

Cas No.: 106612-94-6

Synonym: PROGLUCAGON (78-108) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT);PREPROGLUCAGON 78-108 HUMAN;PREPROGLUCAGON (98-128) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT);INSULINOTROPIN (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT);HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY;H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH;HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG;GLP-1 (HUMAN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG)


106612-94-6


Molecular Formula: C151H228N40O47

Molecular Weight: 3355.67

Assay: ≥99.%

Packing: Export worthy packing

lMaterial Safety Data Sheet: Available on request

Usage: GLP-1 can obviously improve the blood glucose in type 2 diabetes animal models or patients through a variety of mechanisms, which promote the regeneration and repair of islet beta cells, increase the number of beta cells is particularly significant role


Looking for ideal 106612-94-6 Manufacturer & supplier ? We have a wide selection at great prices to help you get creative. All the CAS 106612-94-6 are quality guaranteed. We are China Origin Factory of CAS NO 106612-94-6. If you have any question, please feel free to contact us.

Product Categories : Peptide Synthesis

Product Images
  • 99% Human Growth Hormone Peptide GLP-1 CAS 106612-94-6
Email to this supplier
  • *Subject:
  • *Messages:
    Your message must be between 20-8000 characters
Copyright © 2019 Conbott Pharmtech Co.,Ltd. All rights reserved.
Communicate with Supplier?Supplier
Tommy Mr. Tommy
What can I do for you?