Company Details
  • Conbott Pharmtech Co.,Ltd.

  •  [Zhejiang,China]
  • Business Type:Manufacturer
  • Main Mark: Africa , Americas , Asia , Caribbean , East Europe , Europe , Middle East , North Europe , Oceania , Other Markets , West Europe , Worldwide
  • Exporter:71% - 80%
  • Certs:COS, ISO9001, ISO14010, FDA
  • Description:52232-67-4,CAS 52232-67-4,CAS NO 52232-67-4
Conbott Pharmtech Co.,Ltd. 52232-67-4,CAS 52232-67-4,CAS NO 52232-67-4
Home > Products > Peptide Synthesis > Top Quality Teriparatide Acetate CAS 52232-67-4
Title
  • Title
  • All
Online Service
http://www.conbottpharm.comScan to visit

Top Quality Teriparatide Acetate CAS 52232-67-4

Share to:  
    Payment Type: T/T,L/C
    Min. Order: 1 Gram
    Delivery Time: 10 Days

Basic Info

Model No.: 52232-67-4

Additional Info

Packaging: As required

Productivity: Customized

Brand: Conbottpharm

Transportation: Ocean,Air

Place of Origin: China

Supply Ability: Commercial

Certificate: Documents Support

Product Description

We are one of the Teriparatide Acetate CAS 52232-67-4 suppliers in Chinese market. Teriparatide is a recombinant form of parathyroid hormone. It is an effective anabolic (i.e., bone growing) agent used in the treatment of some forms of osteoporosis and also occasionally used off-label to speed fracture healing. Teriparatide Acetate 52232-67-4 is known for fast action, steady quality and high purity. We are appreciated by lots of clients who we cooperated.


Thera. Category: Teriparatide Acetate

Cas No.: 52232-67-4

Synonym: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4


Molecular Formula: C172H278N52O47S2

Molecular Weight: 3890.49792

Assay: ≥99.%

Packing: Export worthy packing

lMaterial Safety Data Sheet: Available on request

Usage: A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors

Looking for ideal 52232-67-4 Manufacturer & supplier ? We have a wide selection at great prices to help you get creative. All the CAS 52232-67-4 are quality guaranteed. We are China Origin Factory of CAS NO 52232-67-4. If you have any question, please feel free to contact us.

Product Categories : Peptide Synthesis

Product Images
  • Top Quality Teriparatide Acetate CAS 52232-67-4
Email to this supplier
  • *Subject:
  • *Messages:
    Your message must be between 20-8000 characters
Copyright © 2019 Conbott Pharmtech Co.,Ltd. All rights reserved.
Communicate with Supplier?Supplier
Tommy Mr. Tommy
What can I do for you?